DPCstruct | MC10621
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 78 ± 8 aa |
| Standard deviation of domain lengths | 7.67 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 47.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A4QG22 | 1-66 | MTAPVTRAIATIPDDAWETIQYPDAIFDEDTERWISSAEVAEVPFTAFSSQKKAKQIPGRLVVRRI |
| A0A6P1I7W4 | 3-83 | RNPRITRAIASIDEQEWIPVRYPGSVTDPDTGKLISDAEVAEVEYTAFSSRHQVTARLIVRRIKDANYPDALAPSGGTTPS |
| Q8FTS1 | 3-88 | None |
| Q83YL6 | 46-120 | None |
| A0A2W6BWG1 | 9-77 | None |
| A0A2A3F601 | 89-153 | None |
| A0A4V6PXL0 | 236-315 | None |
| A0A1S6RF50 | 66-147 | None |
| A0A6B1MMQ7 | 1-85 | None |
| A0A7X5U1K5 | 139-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.