DPCstruct | MC1062
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 44 ± 1 aa |
| Standard deviation of domain lengths | 1.16 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 88.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.98 |
| Mean intra-cluster sequence similarity (%) | 81.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F9C3K1 | 1-45 | MDYDFKTKLAAEREKVEDLFEYEGCKVGRGTYGHVYKAKRKDGED |
| A0A2L2Y388 | 1-44 | MDFDFKVRTSNERAKVEDLFEYEGCKVGRGTYGHVYKARRKDGS |
| A0A5B7DLA1 | 1-42 | None |
| A0A1L1SSW8 | 1-44 | None |
| A0A817D840 | 1-45 | None |
| A0A4W3JHA5 | 58-102 | None |
| L5MHI5 | 56-98 | None |
| M7BEN7 | 1-43 | None |
| A0A6P4VDY6 | 1-42 | None |
| A0A672RTD6 | 1-45 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.