DPCstruct | MC10619
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 105 ± 15 aa |
| Standard deviation of domain lengths | 14.95 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 39.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0645 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W6DXS0 | 20-97 | QHLAVDAVVAFADGELGSVARDRAAAHLTMCQSCAAEVSAQHQARSVVRSAQCPPVPADLLAALRDIPQTADLPAAPA |
| A0A6P1I3P2 | 1-96 | MASEAIAAFVDGELRMSAYLRAAHHLSICAECAFEVDAQQQARRALRRSADVAMPSGLLGLLSQIPSCNSGEPADKAPFAGPTADST… |
| L7KI62 | 92-187 | None |
| A0A6L7GX09 | 72-173 | None |
| G7GYQ1 | 37-126 | None |
| A0A7H0K178 | 1-104 | None |
| A0A3G8ZVT4 | 7-122 | None |
| A0A238VY46 | 24-111 | None |
| A0A498QBX0 | 80-164 | None |
| A0A1A0K309 | 6-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.