DPCstruct | MC10618
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 135 ± 15 aa |
| Standard deviation of domain lengths | 14.76 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A349E3R7 | 6-140 | SETVVEHIFTTPNPETGSQPPAHFAWILFENDTIYLSFPNELTPLEASFDELANVAKEELHKLGPAVGGTPSADFNVNKVSWYPDDF… |
| A0A6G6K2W6 | 23-171 | VWKPNIPVDLNSVADRAGYYTDHGNTVVIFQHGTCVVLHANAQNPKVEAMDVLEHVFNFHPDFNPQLMDDGNWLVSFSEPNCAALVL… |
| A0A858RGB8 | 44-213 | None |
| A0A6L9QJC9 | 185-303 | None |
| A0A1V6YE99 | 3-130 | None |
| A0A7D4I427 | 11-150 | None |
| A0A5C9EBT3 | 149-275 | None |
| A0A4R4T1R8 | 20-144 | None |
| A0A239BFB2 | 64-201 | None |
| A0A5D0QAN5 | 10-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.