DPCstruct | MC10617
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 126 ± 11 aa |
| Standard deviation of domain lengths | 11.07 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 20.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A4PG53 | 20-152 | SCASKPDSGEDAQVTTMGNFEVTAQLEEIKGDLIDDPLYDYAFVFKYKVLETHRGNLDTETIYVGHYNPLKPRETVADVRSGKIGGN… |
| A0A6G6K1Z6 | 270-384 | PLDPSAPPDERIRTVLAQVTKITQVSKDLCKNAPYPNAMALHQFTTEKGETLLAVVPIMENRSPLPSIYWVAQQWLQVTLQPWDAAT… |
| S4XQU2 | 1-133 | None |
| A0A2E1RQ30 | 226-349 | None |
| A0A2D9K2X3 | 202-337 | None |
| A0A7X8VN50 | 48-166 | None |
| A0A1I2FQV9 | 40-181 | None |
| A0A2V5WQM3 | 313-428 | None |
| A0A850ABK6 | 1-105 | None |
| A0A833M2F1 | 69-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.