DPCstruct | MC10616
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 376 ± 31 aa |
| Standard deviation of domain lengths | 30.86 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 13.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0JNJ9 | 5-371 | VKKDYPAGYPDDALSIIRAMSFADGKNVHIVGSMSLRSQIYAGDYDAYEIVKTHGNRDLALKDIIRKFKHIVRTVSSLPNTYIADIK… |
| A0A6G6JXZ2 | 12-359 | WTADAENAGYVCVGTHRRKIHVPFHLVPALPDLPILEEAIQLSEQICLGAVGKNKAMICLSGSTLLLGDVCRNGDIDFCEYIPPEVD… |
| A0A1V9YL83 | 87-462 | None |
| A0A6C0D0T2 | 1-329 | None |
| F7T7X2 | 639-1009 | None |
| A0A8A6HG48 | 650-1020 | None |
| A0A0C6EZW7 | 10-412 | None |
| A0A2M7QI16 | 126-528 | None |
| A0A6C0HH40 | 16-422 | None |
| A0A6C0HNT6 | 16-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.