DPCstruct | MC10615
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 70 ± 5 aa |
| Standard deviation of domain lengths | 4.52 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 49.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A510J7K6 | 1-69 | MLKAIKASGKNVGFKAAGGVRTAEEAAQYLALAADIMGPQWVTPEHFRFGASSLLNNLLNTLNGNADAA |
| A0A1I8EPU4 | 359-429 | AYIMCQAIKQFYSLTGKKVGFKAAGGIKSTLEALGYQVMVEKILGEEWLEPNLFRIGASSLLNDIINELNK |
| A0A7X8DPH7 | 5-75 | None |
| A0A1I8FIS0 | 70-138 | None |
| A0A7G2LZN5 | 32-104 | None |
| A0A5F5XS33 | 233-299 | None |
| A0A182E6K2 | 33-98 | None |
| A0A1I8FLZ4 | 10-82 | None |
| A0A183DWA1 | 4-70 | None |
| A0A077ZCG9 | 234-300 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.