DPCstruct | MC10614
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 60 ± 4 aa |
| Standard deviation of domain lengths | 4.18 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 36.20 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0437- CL0304 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A844JKU9 | 74-133 | KACWIESDDPAELEAFKKRKYQYMAKDREGRDVFLADSGYVLQMAQMDFKHIKFHFTSEF |
| A0A510J4I2 | 1-62 | MQTARWVYCSDAKMLEEFKRKASTNLAIDGGGYLTYIAPTRVNLQMTQERWPDIRFQPTREH |
| A0A7V3CDP7 | 99-152 | None |
| A0A2P7P438 | 1-69 | None |
| A0A7J6YR34 | 933-987 | None |
| A0A351PZV1 | 164-221 | None |
| A0A812QE26 | 722-784 | None |
| A0A848UTH5 | 301-356 | None |
| A0A7R9L728 | 1131-1189 | None |
| A0A7J6YQW2 | 233-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.