DPCstruct | MC10613
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 181 ± 32 aa |
| Standard deviation of domain lengths | 31.75 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A510J466 | 17-152 | VAPILVFVGMSMIATAFQANDTRYYPAIALAMLPYFANYVMTRFNRGAGEVVSDISSAIVVMGQGAMFMAIFLGAMTVSVIDHQFRR… |
| A0A7S1WIK7 | 2-155 | AMGMIPGLCAWAVHFLQGALAQEPSATLQALVERRPDLCLDGLLAVSSGYLFVSIVLASVYAHVEERRFGSAAVWALVGAGLSAVGM… |
| A0A7S2NSV0 | 10-199 | None |
| A0A7S4F4P7 | 231-508 | None |
| A0A817KP60 | 200-377 | None |
| K1Z773 | 34-230 | None |
| A0A7S2UIB7 | 2-189 | None |
| A0A4R8V8Y8 | 362-518 | None |
| A0A816A2C4 | 88-282 | None |
| A0A819HXK6 | 20-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.