DPCstruct | MC10610
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 89 ± 9 aa |
| Standard deviation of domain lengths | 9.08 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 45.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0477 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H6XNL6 | 1-88 | MQRISRGLLGNIRIVIPPLVEQTQVARFLDHETARIDGLIAEQQRLIELLKEKRQAVISHAVTKGLDPSVPMKDSGVEWLGEVPAHWR |
| A0A455VH62 | 1-101 | MPRANPDFIANAEIPFPPLPEQRAIAAFLDNKSAKIDQAVRIKEAQIKLLRERRQILIQQAVTRGLNPGAPMKDSGIDWIREIPAHW… |
| A0A2D6A4V7 | 88-184 | None |
| A0A2N1ZVL4 | 204-294 | None |
| A0A5B1B4B2 | 8-77 | None |
| A0A455U8G6 | 1-83 | None |
| F3U9A1 | 24-119 | None |
| A0A6L5FBL4 | 138-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.