DPCstruct | MC1061
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 119 ± 6 aa |
| Standard deviation of domain lengths | 5.63 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.74 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 43.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01290 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A653DDR0 | 29-156 | KRTDTREKIVLPTPQDVAAEKTEKALIAGIEHFDTSKLKHTETQEKNPLPDKEVVLQERTHQTLLNGVEHFDKTTMKHTKTTEKVVL… |
| A0A2L2Y1F3 | 1-113 | MSSPSKENLPKVPAPLKDELAQFDSSKMKHTETQEKCSLPSKDDVQQEKAHNSILTGVEGFERSRLNSVETQEKVILPNAEEIEQEK… |
| H3E444 | 1-111 | None |
| A0A0V1A634 | 3-124 | None |
| A0A4Y2CT86 | 86-202 | None |
| A0A1I9WLM0 | 1-125 | None |
| A0A7J7AZ02 | 1-114 | None |
| A0A195BD55 | 1-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.