DPCstruct | MC10608
Metacluster Properties and Pfam Annotations
| Number of structural domains | 125 |
|---|---|
| Mean domain length (aa) | 115 ± 19 aa |
| Standard deviation of domain lengths | 18.55 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 30.85 |
| Pfam Score | 99.02 |
| Assigned Pfam label(s) | CL0063- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A447JK29 | 2-81 | GLTFKNPLGLAAGLDKDGECIDALGAMGFGSLEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNLVENVKKA |
| A0A455V9B0 | 4-134 | YSIARSLLFRLDPETTHGMALNALDALHKVGGIKRVYGEPVSDPVELMGLRFPNRVGLAAGLDKNADHLDALGELGFGFVEVGTVTP… |
| A0A1A9UWV6 | 68-192 | None |
| A0A521UG24 | 259-388 | None |
| A0A1C7E0I7 | 4-146 | None |
| K0TIC3 | 1-131 | None |
| A0A806DUS4 | 1-94 | None |
| A0A0G1HVX6 | 2-101 | None |
| A0A7J6TYK9 | 126-219 | None |
| A0A401FJ53 | 2-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.