DPCstruct | MC10607
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 89 ± 8 aa |
| Standard deviation of domain lengths | 7.76 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377XGE0 | 2-74 | IKELEATGIRKILQIELAVRPDSDQRGMTASGMIVINPPWKLEQQMNNVLPWLHSKLVPTGTGHATVSWIVPE |
| A0A455V8P1 | 2-89 | LMIWYPLLPAGHHETLLSGLEASGIRKIWHSELLLRAAGESAHGMYGSGMVVINPPWGLDEQLAAAMSQVTPLLGSDSHYRAKWLVGE |
| A0A2R4XHJ6 | 213-299 | None |
| A0A1F2SYL2 | 11-99 | None |
| A0A1I7YBE7 | 248-332 | None |
| A0A558HS35 | 206-308 | None |
| A0A7S3ZUL0 | 110-203 | None |
| A0A7X6WCQ8 | 1-86 | None |
| V4QCZ9 | 477-561 | None |
| A0A257VMN0 | 43-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.