DPCstruct | MC10603
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 56 ± 2 aa |
| Standard deviation of domain lengths | 1.85 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 90.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 55.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377W6S0 | 2-56 | YKTTLSGQVWRFDSLKTLMAKASPARSGDALAGIIATSAEERMAAKMALAEVPLT |
| A0A455UUC9 | 1-58 | MAQTYHTTVGSRRYRFSGLAELMAKATPPRSGDRLAGVMAESAEERVVAQMVLAELPL |
| A0A2X3DG51 | 2-55 | None |
| A0A4Q3QP75 | 1-55 | None |
| A0A4P8RF44 | 1-56 | None |
| A0A7X2SGF7 | 1-55 | None |
| A0A447W771 | 177-233 | None |
| A0A133Z343 | 2-53 | None |
| A0A5C9BTB2 | 242-299 | None |
| A0A350T2D4 | 1-56 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.