DPCstruct | MC10602
Metacluster Properties and Pfam Annotations
| Number of structural domains | 73 |
|---|---|
| Mean domain length (aa) | 440 ± 64 aa |
| Standard deviation of domain lengths | 63.54 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 20.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D2I5H5 | 10-308 | AYRLQLIFDAGPTMSMWRPLLRRLRQSLAHDGLFEGVTVSVLTADGTVRGRQVEDDRLVTLVLSDCSGPQWYPGPAGERWYETLRSW… |
| A0A6N2IFG5 | 61-534 | GADDPAQPGAQPPPAVAPHRLFPLHAAPRGKGSGGPEPAPHRAHALRTPGLHVLPSRHLTLGKALRPLRQRLPDRLRQELDVARTVD… |
| A0A1Z1WM53 | 179-735 | None |
| A0A7K2Y3S2 | 38-463 | None |
| A0A0Q6CV82 | 78-579 | None |
| A0A1I6SKP9 | 3-384 | None |
| W5W5Z3 | 2-385 | None |
| A0A370L5Y0 | 368-799 | None |
| A0A1C5GSQ5 | 1-563 | None |
| A0A7W9GIN5 | 16-535 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.