DPCstruct | MC106
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 205 ± 39 aa |
| Standard deviation of domain lengths | 38.95 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 16.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1S411 | 48-246 | FAVDSCRRAEVRHAAECAEVIFAKRSGQTPGLPDKLRGVFWFATNKAEELLFTLEGEEFDKGKRRIAIASGAPYNWTYNADCEGWSY… |
| A0A813E6F9 | 96-295 | AIKLLDVDDCQDKMMSAWGAKSESENLPETLRGVFWMDGNYAPECLAIFMNGAFDPKKRTISLPIGGPYGWTWNSDRAGWFVYFLIV… |
| A0A1Q9DII2 | 450-678 | None |
| A0A7S4I9C1 | 28-208 | None |
| R1BXD8 | 53-325 | None |
| R1BWH4 | 3-194 | None |
| A0A7S1UXX5 | 36-236 | None |
| A0A1Q9CK47 | 1025-1257 | None |
| A0A7S4R6S9 | 45-282 | None |
| A0A1Q9DIJ1 | 59-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.