DPCstruct | MC10594
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 273 ± 49 aa |
| Standard deviation of domain lengths | 48.51 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 37.67 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0240- CL0701 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A1D1X9 | 27-263 | VLLGIPAGVKMQSGVFARSPESAAALVAQLAQGRATTSTAEIVDIDEQARREGIISSVLYERVKVLGSGRQVQGGKLGSRPESQDSL… |
| A0A662IAQ0 | 47-370 | RAKQFISNLTEKDKVEFLTASNLMGEVSLKDFNIKYRIIHQVNDTTGPEDTRAATSKAIREGAELVVFVGGDGTARDVATVSGYVPI… |
| A0A3S2XPG2 | 98-432 | None |
| A0A3M5DMN2 | 1-182 | None |
| A0A534LLU3 | 481-764 | None |
| A0A7J3P945 | 44-339 | None |
| A0A7Y6CEP3 | 40-301 | None |
| A0A509DZW0 | 85-392 | None |
| A0A559QKP8 | 82-392 | None |
| A0A5B8S9V9 | 181-547 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.