DPCstruct | MC10592
Metacluster Properties and Pfam Annotations
| Number of structural domains | 80 |
|---|---|
| Mean domain length (aa) | 257 ± 75 aa |
| Standard deviation of domain lengths | 75.30 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 78.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.99 |
| Pfam Score | 98.36 |
| Assigned Pfam label(s) | PF03469- CL0221- PF12165 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453ELM7 | 4-224 | LEKELHEKRELELEVTRLNGTLQVMKHLEGDDDGDIHDKMEKLSEKLEHERKRLEELSGELVRKERESNDELQEARKELIMGLEDIL… |
| A0A5D2JAK8 | 18-263 | CSLIYEINCKKEQLSQMEREYNEMTATLRGLINGLIAKINSKDSNLWGWELQYNVTVSQLNGKNAALRLAFAQVYSKKKKKKKTNGN… |
| A0A565CCV5 | 2-181 | None |
| A0A443NDX2 | 290-631 | None |
| A0A6D2I1H8 | 2-179 | None |
| A0A453DZX0 | 165-336 | None |
| A0A6D2JJP9 | 893-1205 | None |
| A0A061RPA8 | 142-513 | None |
| A0A843X423 | 69-245 | None |
| A0A3Q7F588 | 46-340 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.