DPCstruct | MC10591
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 63 ± 5 aa |
| Standard deviation of domain lengths | 4.59 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 66.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02092 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7B4HW57 | 62-127 | AAAQADREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERLTTDKGEWLLYRAHVKGEST |
| A0A453QAC5 | 255-318 | KQMEEEVELRGPPVTKAFDQEGKPTKAAEGFCRKNNVPLDSLYRKIDGKTEYIYARVKESARYA |
| A0A151SVV5 | 444-501 | None |
| A0A835RSR4 | 327-384 | None |
| A0A0B7MKG8 | 53-115 | None |
| A0A3B6TB22 | 176-241 | None |
| A0A287VBS8 | 121-184 | None |
| A0A287VBQ5 | 41-104 | None |
| A0A0R0KRN2 | 474-539 | None |
| A0A7V5N1L5 | 4-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.