DPCstruct | MC10590
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 134 ± 15 aa |
| Standard deviation of domain lengths | 15.46 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 54.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843VYU7 | 1-135 | MGWSHPGISLEDLLRLIKGFVDILILASGYRSSGLPASWDAENIKKAISWGAFFENLFSHLSESEEYEVLVKELDEALLELTSSSSF… |
| A0A5D2IV10 | 1-115 | MGWNHPDISLEEMMKLIEGFVDILVLSSGYQSSDLPAHCDSDNIKRGFQWAFFFENVYQESIQELDAALSKMTLHLSFPQARSFLLE… |
| A0A5D2SV23 | 1-118 | None |
| A0A5J5BNY0 | 2-109 | None |
| A0A5J5V432 | 1-136 | None |
| A0A7I8K2F0 | 3-142 | None |
| A0A7J7LPI5 | 1-136 | None |
| A0A1U8G2G2 | 1-143 | None |
| A0A7J0H4I2 | 1-167 | None |
| A0A833R293 | 1-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.