DPCstruct | MC10589
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 233 ± 21 aa |
| Standard deviation of domain lengths | 21.27 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 68.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C0WLB3 | 235-444 | LFNPKLRILLSIVIIIYMGFAFYNLSRSQHKITNPHEKKSIRLIYWGMVFGLIPLGILSLTANWVVEALGLLPVSIVLGLTGLVPIA… |
| A0A3L7XQP5 | 1-245 | MLNSYGFALPSSFQLDDQSQNLILAIFIFSALPLFVIGPFYRYRWRSTPIERQQIKWVVIAIGFAFSLFAIAVSTVFWAPNGNPETD… |
| A0A7V9KCH6 | 28-246 | None |
| A0A6G8Q7Q0 | 364-635 | None |
| A0A838JP14 | 64-266 | None |
| A0A535S4R6 | 1-238 | None |
| A0A2V8YCK0 | 145-408 | None |
| A0A1F8QZM3 | 192-420 | None |
| A0A535X7X0 | 3-232 | None |
| A0A535RUY0 | 88-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.