DPCstruct | MC10584
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 189 ± 18 aa |
| Standard deviation of domain lengths | 18.25 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 15.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W0IW34 | 2-163 | YTAHARQVLVDVEFVREKLEHETSMLEWRLNWVTAVVLIRAVGHILNKVDGKAFPAVRKLANELHQEWKAGGASDEIFKNFIEEERN… |
| A0A3L7WZD8 | 8-206 | PAGDIVQRTEGTLRHAQVELRELLLSVDPELYAAHFRNVIVHGRSVTFVLQQLRSRVHGFDAWYEPWQQEIKEDALLRYCVDVRNDI… |
| A0A1I1NDC4 | 8-214 | None |
| A0A838GT49 | 1-156 | None |
| A0A2A4ZXZ3 | 2-170 | None |
| A0A519HCC0 | 8-186 | None |
| A0A7W6JXP2 | 25-215 | None |
| A0A2A4V535 | 7-197 | None |
| A0A1H4CVA0 | 4-189 | None |
| A0A523WM86 | 3-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.