DPCstruct | MC10582
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 190 ± 33 aa |
| Standard deviation of domain lengths | 32.58 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 22.45 |
| Pfam Score | 98.28 |
| Assigned Pfam label(s) | CL0236- PF11867 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y0H5L7 | 1-207 | MNFNEANSVRDFVRDLLDSPDMEFVPGSELPRTTGSVLLEGPLKAALCRLNPEIEERPELADEVIHRLRAVIFGARSGSLLAANEEF… |
| X0ZB82 | 12-226 | ENPFLVHLHKLSWQIFRQNKDDPEDMKEIKSFNSSGEPVYSESVKFRENFREVILEEELKNSIKRINPWIEEDQITEVLRRITTPQA… |
| F0QS73 | 1-223 | None |
| A0A250KPU1 | 4-211 | None |
| A0A3L7PEN3 | 2-187 | None |
| A0A7T8M3P6 | 251-474 | None |
| A0A0K2RTZ9 | 14-203 | None |
| A0A7X3TC74 | 3-234 | None |
| F0QS69 | 15-176 | None |
| A0A563VPT8 | 1-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.