DPCstruct | MC10581
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 117 ± 14 aa |
| Standard deviation of domain lengths | 13.88 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W6BHN0 | 276-385 | GELKAALGALRLHATSLETPAGRLPAAGLSGFADSAEALWQEHRRTLADLVLVGAPETDAFLTALTEKSPALFLLFDGPAAKALCAV… |
| A0A7Y0GY18 | 5-100 | GETFGGIRLIGDKVMYGGDTWPVAGTTARVEQGADVAKRVTATRLLALGVFALAVKKQQGHVFLTLEGPELDIAVEVLAKKEGDARK… |
| A0A431N9Z2 | 2-112 | None |
| L7LRY3 | 45-162 | None |
| A0A4R6SJV5 | 21-136 | None |
| R7D119 | 2-101 | None |
| A0A421L312 | 5-118 | None |
| A0A506YD43 | 149-279 | None |
| A0A810L481 | 105-228 | None |
| A0A0Q9MGG3 | 140-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.