DPCstruct | MC1058
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 173 ± 34 aa |
| Standard deviation of domain lengths | 34.37 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.29 |
| Pfam Score | 89.01 |
| Assigned Pfam label(s) | PF13089- CL0764 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5T7LRW6 | 3-177 | QERLYIDKEISWLAFNERVLQEAADKRNPLIERVRFLGIYSNNLDEFYKVRFADVKRRILINEERGSRSGSSHARHLIKKIQSKVAK… |
| A0A2R7P1K6 | 19-144 | RDPALYINRELSQLDFNFRVLAQAMDPQVPLLERLRFMCISCTNLDEFFEIRAAAVRHAQEFGLPPAPDGMSPQAILNAIHERAAEL… |
| C7XWA2 | 15-210 | None |
| A0A238UV81 | 51-178 | None |
| A0A258GTM9 | 3-176 | None |
| A0A2H6A6Z4 | 384-583 | None |
| A0A0C1YJJ8 | 28-183 | None |
| M5JLM0 | 29-227 | None |
| A0A316P363 | 58-261 | None |
| U7URE5 | 59-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.