DPCstruct | MC10577
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 62 ± 1 aa |
| Standard deviation of domain lengths | 0.83 |
| Length coefficient of variation | 0.01 |
| Mean AlphaFold2 pLDDT confidence score | 95.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.97 |
| Mean intra-cluster sequence similarity (%) | 57.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02583 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R7ERW4 | 1-59 | MIEKDVYCDDILHQISAVQAAMKSLGKLVLEGHMRSCLIERVQSGDTEVVDELLYTIGK |
| D4LGV6 | 1-62 | MMENDAYCNDILIQSAAVNAAVNAFNKELLASHIRTCVARDIREGKDETIDELVATLQKLMK |
| A0A3D5N0N8 | 1-62 | None |
| A5KKI1 | 1-62 | None |
| F0YTB9 | 1-62 | None |
| A0A2A5S5X9 | 1-62 | None |
| K1U3U3 | 1-62 | None |
| A0A7U9R8T8 | 1-62 | None |
| A0A2R5ELY6 | 1-62 | None |
| W7YY50 | 1-62 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.