DPCstruct | MC10575
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 96 ± 17 aa |
| Standard deviation of domain lengths | 17.16 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 39.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10674 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9RB11 | 56-143 | KYYFVVANAKFMLDEEEHFKELLFERQRNYGERNKEQDFWLVVEPKFLDNFPNITKRLKRPAVALVSTNGTWITFMKLRLDRVLADNF |
| A0A1C9CBL5 | 2-91 | NPYYFALASEKFLLRQEPIEEILRERTKYYEYMNKPIDFWLIKPNLFLEVPEILEVGKKLSGPIAAVISTNVLFITWLKLRLSFVIT… |
| Q10LX5 | 71-143 | None |
| I0YIQ6 | 10-124 | None |
| A0A3G2QYU3 | 8-106 | None |
| A0A7X4F488 | 1-102 | None |
| A0A4S4EI39 | 330-425 | None |
| K8ECD3 | 64-166 | None |
| A0A4Y7LDD9 | 127-198 | None |
| A0A519UKT0 | 13-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.