DPCstruct | MC10572
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 136 ± 21 aa |
| Standard deviation of domain lengths | 20.64 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 15.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1P9X0T1 | 58-212 | IARVIDDTESIIRFVYSPFHVKKDKLRREAFLPPKFRTDVSVQRLRYSDEDICRQIGMSQQRYEIPTKEWKGMAGFKADTVLAKAKN… |
| A0A356NS42 | 5-146 | MMASELVDINDDDCLLRLISEKHVNECKDKDGNGSWRLTTAMFQCSSLSDGESRSTMSVNIKKLIEEAKLNPRTFMISGSYVGVVSF… |
| A0A5M8FRK3 | 12-149 | None |
| H0R2S2 | 1-162 | None |
| D8N5U1 | 43-183 | None |
| A0A418RPS8 | 12-151 | None |
| M6G707 | 1-105 | None |
| L0DHH2 | 12-169 | None |
| A0A533BAY8 | 57-190 | None |
| A0A1N6EFZ7 | 11-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.