DPCstruct | MC10571
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 123 ± 9 aa |
| Standard deviation of domain lengths | 8.91 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A846KMB5 | 2-123 | YALRNEFGGKIFKVPIDGGFDCPNRDGTVAHGGCTFCSVSGSGDMIVAPEDPLPIQFQKEIDMMHQKWPHVQQYIVYFQNFTNTHAP… |
| R7B0K4 | 42-156 | SLNAWLKDQFGQKIYKLALDGGMTCPNRDGTLGTGGCIFCSHGGSGDFAEPAHTSVTEQIEAAKARVANKIKGGKYVAYFQSYTNTY… |
| Q3EQR2 | 10-144 | None |
| A0A7X8J6W7 | 7-131 | None |
| T0E6Q2 | 2-109 | None |
| A0A379C5Q9 | 2-131 | None |
| A0A660LQJ1 | 11-145 | None |
| A0A1Y1RX51 | 102-233 | None |
| R6CSU2 | 15-142 | None |
| A0A6L7EJI9 | 14-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.