DPCstruct | MC1057
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 116 ± 19 aa |
| Standard deviation of domain lengths | 18.99 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 16.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19363 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q8R8F3 | 5-102 | LVDDWVNECALKPIKYFTPTAIEKDTGISLEEVFERLMELVNDNKLELYWRIVCPVCFRQLYIYKSTDRIPRYIDCVECGKQQVTED… |
| A0A1H0BBW0 | 14-119 | HLEDLRTYLNNVRTSSVRHFSVETAFARTDLDKATVQTVFSVLVQEDALKAKIEVRCPHCTAQQGIFTKRSEVPSRSKICIDCEREF… |
| A0A0E2E484 | 6-120 | None |
| A0A454HM27 | 15-111 | None |
| A0A2D9JH52 | 761-880 | None |
| A0A518VCD2 | 1-129 | None |
| A0A2D1KMV5 | 12-135 | None |
| A0A534W748 | 162-292 | None |
| A0A5E8HES6 | 7-120 | None |
| A0A3D2S075 | 192-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.