DPCstruct | MC10569
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 134 ± 29 aa |
| Standard deviation of domain lengths | 28.77 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 85.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9FXB2 | 66-199 | VSATTTTLSPVQIQQVMAVAYSGVVIDASGLGLKPTFSPNIQDTNGRIVYGMQNIDKNFAISHGMVEYSKDIQKASGGTTRAGANPL… |
| A0A7V3MLQ8 | 24-156 | DEAVPAAPAASAKPSEPGKPYTSVIIDATGLGLERCMSPKIRRANGSEVWGTVKVDPDFVEEHGIVAYAKTLDEAKKSDRCGSNPMI… |
| A0A1W9VK82 | 4-84 | None |
| A0A2Z3JL21 | 654-782 | None |
| A0A1E7I929 | 158-295 | None |
| A0A7Y5Q2Q3 | 9-134 | None |
| E8UA18 | 288-420 | None |
| A0A1B7XQ49 | 295-420 | None |
| A0A1V4S0Q3 | 75-199 | None |
| A0A7W0ENW0 | 168-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.