DPCstruct | MC10567
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 130 ± 20 aa |
| Standard deviation of domain lengths | 20.35 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.26 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | PF06935- CL0315 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A098ASP6 | 4-119 | LAFRGYGYSQGFVENYRKIASEVVSTQIEVVGNLDSICSACPNQTKQGKCTEQAKVLELDRRHMEILGIKIGETLTWSEAVEKIREK… |
| A0A7V3I4I7 | 8-151 | EQADRLFIRPHHLMCLMCHYGSGDLEQPLDVDNLHEILVKMRQNPDIPVTLNEGCCMVCDPCPAYDPDKHICLWIYTRDQLKDLRVL… |
| A0A1F5AIP0 | 21-193 | None |
| A0A7Y5SMK8 | 215-378 | None |
| A5MZG5 | 2-95 | None |
| A0A2R6Y3U1 | 55-195 | None |
| A0A7U9ETH0 | 26-165 | None |
| R6NZH6 | 4-90 | None |
| A0A1D3TWW2 | 1-123 | None |
| A0A7V5XGS9 | 2-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.