DPCstruct | MC10560
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 119 ± 8 aa |
| Standard deviation of domain lengths | 8.22 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 57.77 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | PF09791- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E9PL89 | 1-123 | MMAEREEDDDTEEAWMQLRPTEPLPSQCCGSGCSPCVFDLYHRDLARWEAAQASKDRSLLRGPESQSCPSKLNPETFVAFCIIAMDR… |
| A0A452G9Y0 | 1-116 | MDQGEEGDEEEAWLRLRPVEPLPSQCCGSGCSPCVFDVYQRDLARWEAARASKDRSLLSRERHSCPSKLSPETFLAFLISAVDRLTK… |
| A0A4W2EZH9 | 196-320 | None |
| A0A7N4PJN1 | 225-341 | None |
| K1QG42 | 38-158 | None |
| H9H988 | 50-169 | None |
| A0A6P4ZCH2 | 134-239 | None |
| A0A671E2X0 | 1-110 | None |
| A0A5F4C4F8 | 1-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.