DPCstruct | MC1056
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 121 ± 18 aa |
| Standard deviation of domain lengths | 18.01 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 29.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04434 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A285NSZ0 | 14-124 | RQLGEPPRLRFPTDWTLSASWERAQREHDTGGPVSPAERVVLLSEGKPHRVLFAIYDGALRAECDCDGFRYRGWCAHVASCWWRWVR… |
| A0A1H0BAF8 | 3-123 | RQLDFEAERDRGGDSWERADPRAALVEQFGRYGYRITLPGGSVHHLALGHESGIYEGRCDCRGFEYQDGPCAHLCTVRKAVDLALTD… |
| A0A1H8PZM0 | 17-117 | None |
| A0A830FB36 | 5-134 | None |
| A0A830F312 | 3-126 | None |
| A0A830E4A3 | 12-168 | None |
| A0A2R6IPP2 | 11-139 | None |
| C7NYG8 | 3-97 | None |
| M0NZC1 | 15-145 | None |
| A0A2R6D5S7 | 31-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.