DPCstruct | MC10559
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 111 ± 6 aa |
| Standard deviation of domain lengths | 5.99 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 36.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L7KZT9 | 5-109 | GILPLKRVELSLSKFNEVAIPHHLDLMRQHRANIIKYEERGEYGRVRAEQTNARRVSAQLRSLLSELEALRRRVRPEDLPKFDASTQ… |
| E9PIC2 | 1-113 | MSEDEEKVKLRRLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLL… |
| A0A210Q4S1 | 14-115 | None |
| A0A1A9ZU84 | 41-153 | None |
| A0A6S7HX48 | 14-124 | None |
| A0A182FDB1 | 1-106 | None |
| T2MEJ3 | 4-127 | None |
| A0A3S3PEX2 | 11-118 | None |
| A0A1B0FB70 | 246-364 | None |
| A0A2A4IY10 | 1-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.