DPCstruct | MC10558
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 186 ± 15 aa |
| Standard deviation of domain lengths | 15.44 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 64.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 52.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07531 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9WAB5 | 183-331 | PRSEYKGASGCSRSSDNDSPLPSQSLKPELEEGAPGAGNAASRTDEQTDGVALANGTAGASRCVSGIFAGHSKLKRLLGTLVQFATD… |
| E5RHJ8 | 18-210 | TMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDIS… |
| G1L0A3 | 36-215 | None |
| A0A820WNY0 | 2-202 | None |
| A0A2I3MC54 | 19-210 | None |
| A0A6A1QFX8 | 1-171 | None |
| A0A6J0CEZ3 | 64-262 | None |
| A0A673LWB5 | 1-189 | None |
| A0A4U5VMT9 | 57-239 | None |
| A0A7M7T9T6 | 124-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.