DPCstruct | MC10555
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 256 ± 26 aa |
| Standard deviation of domain lengths | 26.04 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 65.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.77 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08633 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G2Q949 | 2-213 | YGLTGLAAEVARVLPNGEKNALRKTYKGHIKRLGVQGHFDEVKQDPNREYSLTYLMKLPQDVWDYQHVRGQDIKDGFSSEVQQKLLR… |
| A0A6G1K1W3 | 6-242 | CLVAHEVSRPHGSQNLFELYNLNDLARSVARTNPVTGEKINKLRKSYEGHIKAMQIAGKPKATKMDEAFTNLLPTRISDEDYFLQRV… |
| A0A167DRF4 | 2-225 | None |
| A0A4V1WTG3 | 282-516 | None |
| A0A074VHI0 | 1-250 | None |
| A0A6G1GH84 | 122-369 | None |
| A0A6A6H6K8 | 146-424 | None |
| K1WZ79 | 47-331 | None |
| A0A1V8TLR0 | 117-407 | None |
| A0A1V6QEY8 | 33-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.