DPCstruct | MC10552
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 123 ± 15 aa |
| Standard deviation of domain lengths | 15.00 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I4ARG0 | 68-172 | NWNWKKGDITRQERDEALLECGSSDIWMSKNYALMKTLTPEEYNGKLLLIKRCMLDDGFTFLGDFSPCENDPIPACDLPVPKRETNR… |
| A0A7W6PLD3 | 1-126 | MRVFILLNLIFILVGCIPLADRSPPPDDYETWKKAGSNNLAVWKVMLECGYASPFRPREKFADGYRTEEQVTESMLCIQKMGYVKYV… |
| J1K9E8 | 1-108 | None |
| A0A4Q7XUD6 | 10-155 | None |
| Q46PY0 | 78-195 | None |
| A0A239SL26 | 13-118 | None |
| A0A843YX41 | 1-137 | None |
| A0A0H3LX37 | 70-206 | None |
| A0A2G2EAI1 | 14-150 | None |
| A0A561DTG0 | 1-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.