DPCstruct | MC10551
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 79 ± 6 aa |
| Standard deviation of domain lengths | 5.91 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M3LY87 | 11-87 | TNLSEGLRATARKWRNANQDHRGGVVLIWQGAVYGWKDSLRDPSDESPGVYAVNEADHIFIAEGGDEYNGAKCWVAA |
| A0A2G2PXU8 | 1-78 | MNKADLIKKRTDYLAENLAAGGVVIINKQGEGCGWSHEVRDPHLWEPGCIAVEENGNCWTASGGNDYDGATYWQLITD |
| A0A2U1CZH4 | 1-80 | None |
| A0A0P9P4S8 | 4-79 | None |
| A0A2A2AU86 | 8-64 | None |
| A0A426CP91 | 3-87 | None |
| A0A2N5BQD6 | 1-80 | None |
| A0A3M3DAM0 | 46-124 | None |
| A0A842HAL4 | 39-127 | None |
| A0A2K4X491 | 2-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.