DPCstruct | MC1055
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 154 ± 22 aa |
| Standard deviation of domain lengths | 21.73 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 15.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G9WH67 | 2-181 | RTMKTTGNTMQRDSDRAQTTQDFAVGISVFLLTVGFTFGFLPTLLSPFGSPVGDDITAKSDRVAGTMINDFAVDGEPRTLNATELDA… |
| A0A2G9P719 | 4-129 | EEFYAEMQEKAVNASQVLVATKGNPDSWVKLNDLTGINSIGLAKENNVLDENKVDTLVDWNALKYAEIKEVLGLQKYDFYFKITEMD… |
| A0A343TFT3 | 16-173 | None |
| A0A2R6CNT7 | 3-135 | None |
| A0A7J4JKU2 | 23-194 | None |
| A0A2G9N5N4 | 12-141 | None |
| A0A7T5R9E3 | 2-147 | None |
| A0A497S715 | 10-157 | None |
| A0A7J4T8C6 | 6-194 | None |
| A0A7J2ZFW5 | 1-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.