DPCstruct | MC10547
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 182 ± 15 aa |
| Standard deviation of domain lengths | 14.67 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 70.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 30.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06746 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P5Z971 | 19-188 | VYETQGTFSLPLYLKNFPKVGQDFESFAYKGMKDFMGDLEGKCPETTEFKDFFVKLKDYMACYSSTSPGSKDLQVELSIKSEKLYRA… |
| A0A654G6N0 | 37-210 | EDPLTVKDVESYTIKVVTTFLVELEKECPKTEKFKVFFEKLKAYSKYLCPVSKAKGYKSDMKAKAGSLFEAMSALISVKHRSKEGSV… |
| A0A6D2JDL6 | 39-227 | None |
| A0A078IBN9 | 19-205 | None |
| A0A397XQY3 | 21-186 | None |
| A0A178VAD3 | 157-335 | None |
| A0A087GE38 | 20-183 | None |
| V4K4X6 | 4-214 | None |
| A0A6J0N4U5 | 1-192 | None |
| A0A6D2LDA4 | 27-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.