DPCstruct | MC10546
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 256 ± 26 aa |
| Standard deviation of domain lengths | 26.42 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04859 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A2YA69 | 2-196 | VFAGVTSIKAAYAELQLAQHPYNNNAIQAANEVVVEQLKILSELKHKFLKKELDVSPQVTLMLTEIQEQQSLMRTYEIRIKKLESDI… |
| A0A654FVL5 | 12-282 | MEALISNLFGNISSLKSAYIELQSAHTPYDPEKIQAADKVVNSELKNLSEMKHSYRENNPKPVCVSPQDSRLAAEIQEQQSLLKTYY… |
| A0A4S8I7H4 | 58-340 | None |
| A0A7I8JMY0 | 2-235 | None |
| A0A1R3HWR3 | 67-342 | None |
| A0A396HZ95 | 13-259 | None |
| A0A6J5X4D8 | 110-392 | None |
| A0A3L6TUE7 | 32-243 | None |
| A0A427AU27 | 608-880 | None |
| O65647 | 1-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.