DPCstruct | MC10545
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 100 ± 16 aa |
| Standard deviation of domain lengths | 16.15 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 91.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.57 |
| Pfam Score | 97.73 |
| Assigned Pfam label(s) | CL0027- PF01139 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812AF82 | 5-122 | LRQIDKYRFLIPKQGNMYTDGIIYTTSEMLELIKNDQSLKQVANVACLPGIVGPSLAMPDIHEGYGFPIGGVAAFDLETGIISPGGV… |
| A0A7U6QQ75 | 7-107 | LNKSGKHGVPVKIYTSDIEQGAMQQLRNLAQLEFVHSHIAVMPDVHVGKGATVGSVIPTKSAIIPAAVGVDIGCGMNAVRLSLTASD… |
| A0A7X6C873 | 4-75 | None |
| A0A0S4JN45 | 55-161 | None |
| A0A146HZ08 | 91-199 | None |
| A0A0G1HLX9 | 5-73 | None |
| A0A1V4WXI7 | 28-98 | None |
| A0A6A5QHX6 | 1-111 | None |
| A0A143YWU1 | 1-125 | None |
| A0A1M6H6M4 | 4-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.