DPCstruct | MC10544
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 97 ± 13 aa |
| Standard deviation of domain lengths | 13.32 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10709 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B1BKJ2 | 15-89 | TRIITKVEFGGEWPFRTDRVIVECQNNMFCIVHINGYAFGLNGAAQSRFKIPCPHAAGLAVLGKSVGPFIDMAFE |
| A0A7U6QPG9 | 8-113 | GCSNPEPQSEVVADNERAVSRDSYAGDWPFTDNSGVLGCIDKAAYFDAGNETYALNGFSRAYSDNKGLGWIPVTPEQPFWLDNPDIE… |
| A0A6G8FI13 | 3-120 | None |
| A0A0F9FQY5 | 223-312 | None |
| A0A661DAX1 | 455-547 | None |
| A0A223S3M9 | 7-105 | None |
| A0A0F9MTD1 | 2-85 | None |
| D2SG35 | 12-88 | None |
| A0A377CJS0 | 292-381 | None |
| A0A1R0V6W0 | 86-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.