DPCstruct | MC10542
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 64 ± 9 aa |
| Standard deviation of domain lengths | 8.91 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 53.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0697 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090RJ64 | 22-89 | YESDMLFHTENLPLHENGMTITAFASSGEQVGFETYYSIGGGFIATADELAHGSKSQSVQVSFPFSTA |
| A0A7U6QN96 | 2-79 | SGIHTIAFDTEQDIYWYDDTVLPYHPNALTLRAISTDGTRYQQTYYSIGGGFVINKEDATDPDEDHASPTIDSVPYPF |
| A0A376Y4I5 | 5-77 | None |
| A0A3S4GNA7 | 1-58 | None |
| A0A378FRI7 | 95-149 | None |
| A0A3S4UNI2 | 3-65 | None |
| A0A377A3M8 | 91-149 | None |
| A0A484Z9J5 | 1-59 | None |
| A0A447XWE3 | 1-62 | None |
| A0A177WP73 | 31-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.