DPCstruct | MC10541
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 129 ± 11 aa |
| Standard deviation of domain lengths | 10.94 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M5S8U4 | 2-138 | QQRDSVFYTVGVAAVLCVVCSLAVSFAAVQLRPLQEENKKLDRQRNILDAAGLSMGEFGKPASELSRDQVADLYSRVSEKLVDLETG… |
| A0A7U6KT37 | 1-139 | MSKPKSNNAKTISVALTLCLVCSVLVSAVAVGLKPAQIENARLDRNKNILVAADMYNTESDTADDVAERFKDFDVKIIDLNKGNYLD… |
| A0A3S4E4I5 | 1-113 | None |
| A0A2E2LVV3 | 1-128 | None |
| A0A0G3B458 | 1-143 | None |
| A0A3S4TYD9 | 2-138 | None |
| A0A543QIQ8 | 19-146 | None |
| A0A7C5CQ88 | 5-142 | None |
| A0A7G5LNJ2 | 15-140 | None |
| A0A812PLD9 | 801-933 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.