DPCstruct | MC10540
Metacluster Properties and Pfam Annotations
| Number of structural domains | 101 |
|---|---|
| Mean domain length (aa) | 107 ± 17 aa |
| Standard deviation of domain lengths | 16.57 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 91.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01493 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7S2Y0 | 122-218 | MTGGQVVILGPTGGNFGAGMTGGMAFVLDQHSRFEARINPESIVVQRLASPYWEGVLRSLVAEHARETDSAFAESLLRDWDRVRDLF… |
| A0A7U6KS83 | 213-309 | MTGGIVTILGRTGLNFGAGMTGGFAYVLDMEGDFFDRCNHELIDLNRISSEQTEEHRIHLQQVIEAHVDKTGSAWGQTILDDFEHYV… |
| A0A7Y4U9H8 | 865-969 | None |
| A0A829BXK9 | 1-72 | None |
| A0A1R3L0Q2 | 21-119 | None |
| A0A2H5ZX15 | 289-389 | None |
| A0A3C1VEV3 | 21-113 | None |
| A0A7C2L3K6 | 132-239 | None |
| A0A397EI07 | 659-766 | None |
| A0A257STM8 | 301-411 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.