DPCstruct | MC1054
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 164 ± 20 aa |
| Standard deviation of domain lengths | 19.60 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 25.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20509 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G9UET9 | 24-212 | MGHRALVAYGRADGTYSLHHSQWGALGFALSDDLGPDSPFGADADWEQAAHEALVDGERPEVPPDHDAPVDPEPRGSIRALDGLPKR… |
| A0A830GEU4 | 1-207 | MGHRALVAYERPDGQYNLHYSHRGAKNLQLKQTLTLGTPFGEYTSENGWTNRVYESLQTATQASIPTPRRGESRTPTRVRVEPCAVS… |
| A0A4D6HTZ3 | 11-154 | None |
| A0A2R6CZ40 | 1-157 | None |
| A0A6G8TEG5 | 1-175 | None |
| A0A2R6CGK1 | 1-164 | None |
| A0A1I0D575 | 1-160 | None |
| A0A2R6M6H0 | 10-182 | None |
| A0A2R6ETJ8 | 1-185 | None |
| M0KWH1 | 48-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.