DPCstruct | MC10539
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 254 ± 22 aa |
| Standard deviation of domain lengths | 21.67 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 21.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13387 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N3UER5 | 2-244 | ARMVEHVWELRQVRFDYYFFDENCSFRLLELLEVARPSLRLTDQFPLTAIPADTVRAVREAGLITEVNYRPSRERELLARAAPLTAD… |
| A0A7U6KRU7 | 1-263 | MILIPKKLAKYLQDDERDTWTYQLNLTSSEVQQVMRHVWETKSLKMPYYFTTDNCASEILRLIDVIRPQQNLLKQLAYVVVPSDVIQ… |
| A0A3D8HUT1 | 327-609 | None |
| A0A521Q7C3 | 230-493 | None |
| A0A2E5JIN1 | 99-360 | None |
| A0A166XS23 | 2-211 | None |
| A0A176RV13 | 67-338 | None |
| A0A533XPP9 | 254-490 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.