DPCstruct | MC10538
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 80 ± 5 aa |
| Standard deviation of domain lengths | 5.35 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 54.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0YL63 | 17-89 | VIYVFKKDKEIRPKTLGQQKYINSVRKNDIVFVIGPAGTGKTYLAVAIALSALKNKEVDRIILVRPAVEAGES |
| T1AQ93 | 15-91 | GIRLPRGGVRARGHHQRQYLSNIHSHDLTFGVGPAGTGKTYLAVACAVESLQAETIHRVVLVRRRWKPASGSASCPA |
| A0A377Z6M4 | 51-136 | None |
| A0A447U7M0 | 1-87 | None |
| A0A6G3VJH7 | 52-132 | None |
| A0A844VXL4 | 1-84 | None |
| A0A0A0IQ40 | 79-150 | None |
| W7Y7Y8 | 102-176 | None |
| A0A1V4QWZ3 | 117-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.